General Information

  • ID:  hor005251
  • Uniprot ID:  P19209
  • Protein name:  Somatostatin 34
  • Gene name:  sst
  • Organism:  Myxine glutinosa (Atlantic hagfish)
  • Family:  Somatostatin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Myxine (genus), Myxininae (subfamily), Myxinidae (family), Myxiniformes (order), Myxini (class), Cyclostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  AVERPRQDGQVHEPPGRERKAGCKNFFWKTFTSC
  • Length:  34(1-34)
  • Propeptide:  AVERPRQDGQVHEPPGRERKAGCKNFFWKTFTSC
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Somatostatin inhibits the release of somatotropin.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  23-34
  • Structure ID:  AF-P19209-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-P19209-F1.pdbhor005251_AF2.pdbhor005251_ESM.pdb

Physical Information

Mass: 455224 Formula: C173H265N55O49S2
Absent amino acids: ILMY Common amino acids: R
pI: 9.66 Basic residues: 8
Polar residues: 9 Hydrophobic residues: 8
Hydrophobicity: -120.88 Boman Index: -10805
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 22.94
Instability Index: 4239.12 Extinction Coefficient cystines: 5625
Absorbance 280nm: 170.45

Literature

  • PubMed ID:  2896118
  • Title:  Primary structures of somatostatins from the islet organ of the hagfish suggest an anomalous pathway of posttranslational processing of prosomatostatin-1.